PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo5G0075100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 215aa    MW: 23760 Da    PI: 9.9591
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo5G0075100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ll ++++ +G g+W++ ++  g++R++k+c++rw++yl
   Spipo5G0075100 14 RGAWTSQEDKLLSEYIAAHGLGRWRSLPKNAGLNRCPKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding54.82.1e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+eE+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
   Spipo5G0075100  67 RGNVTEEEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTC 111
                      7888******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.652961IPR017930Myb domain
SuperFamilySSF466895.24E-3011108IPR009057Homeodomain-like
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-231568IPR009057Homeodomain-like
CDDcd001673.46E-111661No hitNo description
PROSITE profilePS5129425.83362116IPR017930Myb domain
SMARTSM007172.1E-1666114IPR001005SANT/Myb domain
PfamPF002492.3E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-2569115IPR009057Homeodomain-like
CDDcd001674.44E-977110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MVRGGCSPQE GLKRGAWTSQ EDKLLSEYIA AHGLGRWRSL PKNAGLNRCP KSCRLRWLNY  60
LRPGIKRGNV TEEEEELIIR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT CLRKKAAGDL  120
PKKHHPRCPS GGGDPDGGGA TAPPVIRTKA HRCTRFVVKN QVTDVAGDLP EPSIPVASAD  180
SGFRQNLYLQ VVSPPPLEFD VDGFFTHHGV QNSPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009393952.11e-71PREDICTED: transcription factor TT2-like
SwissprotQ9FJA21e-56TT2_ARATH; Transcription factor TT2
TrEMBLM0SID69e-72M0SID6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P27700_0013e-71(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-57MYB family protein